travel/minis skin & body

19327 611596 611596 4 active moist SAMPLE Dermalogica Dermalogica active moist SAMPLE dermalogica/611596dermalogicaactivemoisttube.jpg Special Offer Available 0.20 0.20 0.20 False False False False 0.00 False False Diversion contract is required Dermologica active moist is a light, oil-free lotion that helps improve skin texture and combat surface dehydration. True Log in to view pricing! False

19320 111319 111319 1 dynamic skin recovery spf50 0.4 Fl. Oz. Dermalogica Dermalogica age smart dynamic skin recovery spf50 0.4 Fl. Oz. dermalogica/111319dermalogicadynamicskinrecoveryspf50tube.jpg Special Offer Available 11.75 11.75 11.75 False False False False 0.00 False False Diversion contract is required Help minimize skin-aging triggers with this medium-weight, emollient daily moisturizer with Broad Spectrum SPF50. True Log in to view pricing! False

135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Special Offer Available 0.40 0.40 0.40 False False False False 0.00 False False Diversion contract is required Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing! False

101551 611431 611431 1 cooling aqua jelly moisturizer SAMPLE Dermalogica Dermalogica clear start cooling aqua jelly moisturizer SAMPLE dermalogica/dermalogicaclearstartcoolingaquajellysample.jpg Special Offer Available 1.60 1.60 1.60 False False False False 0.00 False False Diversion contract is required Dermalogica clear start cooling aqua jelly is a weightless moisturizer that provides dewy hydration for oily skin. Achieve balanced hydration with all the glow and none of the shine. True Log in to view pricing! False

19307 111248 111248 1 daily microfoliant - travel bright 0.45 Fl. Oz. Dermalogica Dermalogica daily microfoliant - travel bright 0.45 Fl. Oz. dermalogica/dermalogicadailymicrofoliant045oz.jpg Special Offer Available 9.50 9.50 9.50 False False False False 0.00 False False Diversion contract is required Dermalogica daily microfoliant is a gentle, daily use exfoliating powder that sloughs away dead skin cells, instantly leaving skin smoother and brighter. For use with all skin conditions. True Log in to view pricing! False

133384 411453 411453 1 daily milkfoliant 0.45 Fl. Oz. Dermalogica Dermalogica daily milkfoliant 0.45 Fl. Oz. dermalogica/dermalogicadailymilkfoliant045oz.jpg Special Offer Available 9.50 9.50 9.50 False False False False 0.00 False False Diversion contract is required Make peace with daily exfoliation. Dermalogica's daily milkfoliant exfoliator gently polishes to reveal smoother, more vibrant skin, replenishes and restores skin's moisture barrier and relieves skin with calming and soothing ingredients. True Log in to view pricing! False

141352 611465 611465 1 retinol serum SAMPLE Dermalogica Dermalogica dynamic skin retinol serum SAMPLE dermalogica/dermalogicadynamicskinretinolserumsample.jpg Special Offer Available 0.70 0.70 0.70 False False False False 0.00 False False Diversion contract is required Dermalogica's dynamic skin retinol serum is a high-dose, fast-acting multi-retinoid with booster technology that helps reverse the appearance of wrinkles, retexturize skin and minimize the appearance of pores, and even skin tone. True Log in to view pricing! False

67732 111325 111325 1 skin smoothing cream 0.5 Fl. Oz. Dermalogica Dermalogica skin smoothing cream 0.5 Fl. Oz. dermalogica/111325dermalogicaskinsmoothingcreamtube.jpg Special Offer Available 8.75 8.75 8.75 False False False False 0.00 False False Diversion contract is required Now with a continuous 48 hours of hydration, skin smoothing cream with Active Hydramesh Technology improves skin hydration by 80%, protects against environmental factors, and locks in moisture. True Log in to view pricing! False

122120 29444 29444 1 Moisture Lotion Hand & Body Cream 1.7 Fl. Oz. ELEVEN Australia ELEVEN Australia Moisture Lotion Hand & Body Cream 1.7 Fl. Oz. elevenaustralia/elevenMoistureLotionHandBodyCream1.7floz.jpg Special Offer Available 4.50 4.50 4.50 False False False False 0.00 False False Diversion contract is required ELEVEN Australia Moisture Lotion Hand & Body Cream is a moisturizing blend of aloe and organic cucumber to hydrate the skin True Log in to view pricing! False

122122 29443 29443 1 Wash Me All Over Hand & Body Wash 1.7 Fl. Oz. ELEVEN Australia ELEVEN Australia Wash Me All Over Hand & Body Wash 1.7 Fl. Oz. elevenaustralia/elevenWashMeAllOverHandBodyWash1.7floz.jpg Special Offer Available 4.50 4.50 4.50 False False False False 0.00 False False Diversion contract is required ELEVEN Australia Wash Me All Over Hand & Body Wash is a SLS free formula with a blend of papaya, jojoba oil and sweet almond oil. True Log in to view pricing! False

84664 921296 921296 1 Cashmere Cleanse Travel 1.6 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Cashmere Cleanse Travel 1.6 Fl. Oz. hydropeptide/cashmerecleansetravel2.jpg Special Offer Available 8.00 8.00 8.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Cashmere Cleanse Facial Rose Milk is a comforting cleanser that gently whisks away daytime impurities without stripping or drying the skin. True Log in to view pricing! False

84669 921255 921255 1 Hydro-Lock Sleep Mask 2.53 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Hydro-Lock Sleep Mask 2.53 Fl. Oz. hydropeptide/hphydrolocksleepmask.jpg Special Offer Available 44.00 44.00 44.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Anti-Wrinkle + Restore Hydro-Lock Sleep Mask Royal Peptide Treatment is a luxurious sleeping mask that blankets the contours of skin with a layer of intense, restorative hydration. True Log in to view pricing! False

84693 921297 921297 1 Moisture Reset Phytonutrient Facial Oil Travel 0.1 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Moisture Reset Phytonutrient Facial Oil Travel 0.1 Fl. Oz. hydropeptide/moistureresettravel1.jpg Special Offer Available 9.50 9.50 9.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Moisture Reset Phytonutrient Facial Oil is an antioxidant-rich blend of precious oils that locks in moisture and helps protect skin from environmental stressors and free radicals. True Log in to view pricing! False

39541 921294 921294 1 Cleansing Gel Travel 1.6 Fl. Oz. HydroPeptide HydroPeptide Cleansing Gel Travel 1.6 Fl. Oz. hydropeptide/cleansinggeltravel2.jpg Special Offer Available 5.00 5.00 5.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Cleansing Gel is a cleanser, toner, and makeup remover. True Log in to view pricing! False

39542 921287 921287 1 Exfoliating Cleanser Travel 1 Fl. Oz. HydroPeptide HydroPeptide Exfoliating Cleanser Travel 1 Fl. Oz. hydropeptide/hypexfoliatingcleanser1oz.jpg Special Offer Available 7.00 7.00 7.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Exfoliating Cleanser is an energizing cleanser that features a moisture-rich lather and eco-friendly jojoba esters to leave skin feeling soft and clean without stripping healthy oils. True Log in to view pricing! False