10% off non-sale items and reduced shipping for orders over $250!
Save 10% Sitewide plus Reduced Shipping on orders over $250! Ends 5/28.
10% off non-sale items + reduced shipping for orders over $250

cosmetics lips

(26 Items)
  • 153783 BodyColorCassetteLiquid BodyColorCassetteLiquid 1 Color Cassette Liquid Blush Lip 0.19 Fl. Oz. bodyography bodyography Color Cassette Liquid Blush Lip 0.19 Fl. Oz. False bodyographycosmetics/bdgycolorcassetteliquidblushlip.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required bodyography Color Cassette Liquid Blush Lip is a skincare-infused, multi-tasking liquid blush + lip product; it effortlessly blends and layers for your desired intensity. True Log in to view pricing! False
    bodyography Color Cassette Liquid Blush Lip

    bodyography
    Color Cassette Liquid Blush Lip

    Bonus Offer
    View Details
  • 131991 BG Fabric Lip Stick BG Fabric Lip Stick 1 Fabric Texture Lipstick Click to View Colors bodyography bodyography Fabric Texture Lipstick Click to View Colors False bodyography/bodyographyfabrictexturelipstickmaster.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required bodyography's Fabric Texture Lipstick is a demi-matte lipstick that is light as air with rich, sumptuous color payoff and a next-to-nothing naked feel. True Log in to view pricing! False
    bodyography Fabric Texture Lipstick

    bodyography
    Fabric Texture Lipstick

    Bonus Offer
    View Details
  • 132944 BG Lip Gloss BG Lip Gloss 1 Lip Gloss Click to View Colors bodyography bodyography Lip Gloss Click to View Colors False bodyography/bodyographylipglossmaster.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required bodyography's Lip Gloss is a moisturizing, non-sticky gloss that looks as good as it feels! True Log in to view pricing! False
    bodyography Lip Gloss

    bodyography
    Lip Gloss

    Bonus Offer
    View Details
  • 133236 BGLipGlossTESTER BGLipGlossTESTER 1 Lip Gloss TESTER Click to View Colors bodyography bodyography Lip Gloss TESTER Click to View Colors False bodyography/bodyographylipglossmastertester.png Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required bodyography's Lip Gloss is a moisturizing, non-sticky gloss that looks as good as it feels! True Log in to view pricing! False
    bodyography Lip Gloss TESTER

    bodyography
    Lip Gloss TESTER

    Bonus Offer
    View Details
  • 85646 BO Lip Lava Liquid Lipsti BO Lip Lava Liquid Lipsti 1 Lip Lava Liquid Lipstick Click to View Colors bodyography bodyography Lip Lava Liquid Lipstick Click to View Colors False bodyography/bodyographyliplavalipstickmaster.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required The bright, bold, ultra-soft matte and metallic finishes of bodyography's Lip Lava Liquid Lipstick go on opaque and dry instantly. True Log in to view pricing! False
    bodyography Lip Lava Liquid Lipstick

    bodyography
    Lip Lava Liquid Lipstick

    Bonus Offer
    View Details
  • 85630 80404 80404 1 Lip Lava Liquid Lipstick Intro 31 pc. bodyography bodyography Lip Lava Liquid Lipstick Intro 31 pc. False bodyography/boliplavalipstickintro.jpg Special Offer Available 240.00 240.00 240.00 False False True False 0.00 False False Diversion contract is required bodyography Lip Lava Liquid Lipstick has bright, bold, ultra-soft matte and metallic finishes, are long-wearing, go on opaque, and dry instantly. True Log in to view pricing! False
    bodyography Lip Lava Liquid Lipstick Intro 31 pc.

    bodyography
    Lip Lava Liquid Lipstick Intro

    31 pc.

    SKU 80404

    Bonus Offer
    Quick View
  • 133083 BOLipLavaLipstickTESTER BOLipLavaLipstickTESTER 1 Lip Lava Liquid Lipstick TESTER Click to View Colors bodyography bodyography Lip Lava Liquid Lipstick TESTER Click to View Colors False bodyography/bodyographyliplavalipstickmastertester.png Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required The bright, bold, ultra-soft matte and metallic finishes of bodyography's Lip Lava Liquid Lipstick go on opaque and dry instantly. True Log in to view pricing! False
    bodyography Lip Lava Liquid Lipstick TESTER

    bodyography
    Lip Lava Liquid Lipstick TESTER

    Bonus Offer
    View Details
  • 131881 BG Lip Pencil BG Lip Pencil 1 Lip Pencil Click to View Colors bodyography bodyography Lip Pencil Click to View Colors False bodyography/bodyographylippencilmaster.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required bodyography Lip Pencil glides on like your favorite lipstick with precise, pigment-rich color to frame, fill in, and define lips. True Log in to view pricing! False
    bodyography Lip Pencil

    bodyography
    Lip Pencil

    Bonus Offer
    View Details
  • 131841 80754 80754 1 Lip Treatment 0.13 Fl. Oz. bodyography bodyography Lip Treatment 0.13 Fl. Oz. False bodyography/bodyologyliptreatment.jpg Special Offer Available 9.50 9.50 9.50 False False True False 0.00 False False Diversion contract is required bodyography's Lip Treatment is a glossy, daily therapy moisture stick containing Aloe Vera, Shea Butter, and Vitamins C, D, & E. True Log in to view pricing! False
    bodyography Lip Treatment 0.13 Fl. Oz.

    bodyography
    Lip Treatment

    0.13 Fl. Oz.

    SKU 80754

    Bonus Offer
    Quick View
  • 131966 BG Lip Stick BG Lip Stick 1 Lipstick Click to View Colors bodyography bodyography Lipstick Click to View Colors False bodyography/lipstick_maplesugar_swatch_web_1024x1024.png Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required bodyography's Lipstick is long-lasting, super-pigmented formula contains a moisturizing Aloe Vera-base to help protect the lips from signs of aging. True Log in to view pricing! False
    bodyography Lipstick

    bodyography
    Lipstick

    Bonus Offer
    View Details
  • 27428 GrandeLips GrandeLips 1 Hydrating Lip Plumper Click to View Colors Grande Cosmetics Grande Cosmetics GrandeLIPS Hydrating Lip Plumper Click to View Colors False grandecosmetics/grandelipsplumperv2.jpg Special Offer Available 13.50 13.50 13.50 False False False False 0.00 True False Diversion contract is required GrandeLIPS is a high gloss, volumizing lip plumper infused with a nourishing cocktail of Volulip™ and hyaluronic acid for instant and long-term hydrating benefits. True Log in to view pricing! False
    Grande Cosmetics Hydrating Lip Plumper

    Grande Cosmetics
    GrandeLIPS Hydrating Lip Plumper

    Bonus Offer
    View Details
  • 84676 921256 921256 1 Lip Service Hydrating Line Lifter 0.34 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Lip Service Hydrating Line Lifter 0.34 Fl. Oz. False hydropeptide/hplipservice.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Anti-Wrinkle + Restore Lip Service Hydrating Line Lifter is an advanced anti-aging treatment for lips that combines plumping peptides with hydrating and smoothing fruit extracts for instant relief from dryness and flaking. True Log in to view pricing! False
    HydroPeptide Lip Service Hydrating Line Lifter 0.34 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Lip Service Hydrating Line Lifter

    0.34 Fl. Oz.

    SKU 921256

    Bonus Offer
    Quick View
  • 84685 921257 921257 1 LipLock Hydrator Peptide Infused Lip Mask 0.16 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask 0.16 Fl. Oz. False hydropeptide/hpliplockhydrator.jpg Special Offer Available 21.00 21.00 21.00 False False False False 0.00 False False Diversion contract is required Meet HydroPeptide's Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask. This nighttime (or anytime) mask gives lips intense hydration, leaving them smooth, soft and plumped with moisture. True Log in to view pricing! False
    HydroPeptide LipLock Hydrator Peptide Infused Lip Mask 0.16 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask

    0.16 Fl. Oz.

    SKU 921257

    Bonus Offer
    Quick View
  • 39538 920122 920122 1 Perfecting Gloss - Beach Blush 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Beach Blush 0.17 Fl. Oz. False hydropeptide/perfectingglossbeachblushr.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Perfecting Gloss - Beach Blush is a lip enhancing treatment. True Log in to view pricing! False
    HydroPeptide Perfecting Gloss - Beach Blush 0.17 Fl. Oz.

    HydroPeptide
    Perfecting Gloss - Beach Blush

    0.17 Fl. Oz.

    SKU 920122

    Bonus Offer
    Quick View
  • 39539 920124 920124 1 Perfecting Gloss - Berry Breeze 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Berry Breeze 0.17 Fl. Oz. False hydropeptide/perfectingglossberrybreezer.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Perfecting Gloss - Berry Breeze is a lip enhancing treatment. True Log in to view pricing! False
    HydroPeptide Perfecting Gloss - Berry Breeze 0.17 Fl. Oz.

    HydroPeptide
    Perfecting Gloss - Berry Breeze

    0.17 Fl. Oz.

    SKU 920124

    Bonus Offer
    Quick View
(26 Items)